PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna15525.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 383aa    MW: 40637.5 Da    PI: 10.294
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna15525.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.34.8e-58191286297
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe+yveplk+yl
  mrna15525.1-v1.0-hybrid 191 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYL 276
                              89************************************************************************************ PP

                    NF-YB  88 kkyrelegek 97 
                              +kyre+egek
  mrna15525.1-v1.0-hybrid 277 QKYREMEGEK 286
                              ********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.0E-54185290IPR009072Histone-fold
SuperFamilySSF471135.43E-40193290IPR009072Histone-fold
PfamPF008082.1E-27196260IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.0E-21224242No hitNo description
PROSITE patternPS006850227243IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.0E-21243261No hitNo description
PRINTSPR006153.0E-21262280No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MNQGVKVRAP PQPGYSSSSQ TRQKPTIRSY LNHIFTVTRV KPNSKGKDGK ASRIISFKWC  60
KTLTRALMQN HLNKLASRQQ NLQKDCYITC KILNRQDLRP HNPSNTPKPA TCTTLIVKQT  120
DHPPPRVAAQ HYYPTDPTDP NKSSPQSLSL FNAAAQLLRR TRKPYQSPMA DSDNDSGGHN  180
GHSQGGELSA REQDRFLPIA NVSRIMKKAL PANAKISKDA KETVQECVSE FISFVTGEAS  240
DKCQREKRKT INGDDLLWAM TTLGFEEYVE PLKIYLQKYR EMEGEKGAAV GTAGRDKDGG  300
SGGGGSAAGG GGGGGGGSSG GGLSSGTSGG GGAFNGVYGG MGMLGHHQGH VYGSGGYQHQ  360
MGVGVGAEKR SGSGGGASVR SR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A6e-46188281194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B6e-46188281194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004305679.11e-150PREDICTED: nuclear transcription factor Y subunit B-3-like
TrEMBLA0A0D2TG812e-79A0A0D2TG81_G
STRINGVIT_19s0015g00440.t012e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-74nuclear factor Y, subunit B3